PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G65310.1
Common NameATHB5, ATHB-5, HB5, MNA5.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 312aa    MW: 34790.6 Da    PI: 4.754
Description homeobox protein 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G65310.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1874125556
                  SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++  eq+++Le+ Fe ++++  e++ +LA++lgL+ rqV +WFqNrRa++k
  AT5G65310.1  74 RRLGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWK 125
                  467789*********************************************9 PP

2HD-ZIP_I/II129.21.6e-4171163193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl  eqvk+LE++Fe ++kLeperKv+la+eLglqprqva+WFqnrRAR+ktkqlE+dy +Lk+++dalk+++++L++++++L  ++ke
  AT5G65310.1  71 EKKRRLGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALKRNRDSLQRDNDSLLGQIKE 163
                  69*************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.18E-1963129IPR009057Homeodomain-like
PROSITE profilePS5007117.4167127IPR001356Homeobox domain
SMARTSM003895.3E-1870131IPR001356Homeobox domain
CDDcd000867.49E-1772128No hitNo description
PfamPF000466.3E-1673125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.5E-2076134IPR009057Homeodomain-like
PRINTSPR000317.8E-698107IPR000047Helix-turn-helix motif
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PRINTSPR000317.8E-6107123IPR000047Helix-turn-helix motif
PfamPF021835.5E-17127168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000003anatomywhole plant
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003000anatomytransition zone
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007057developmental stageseed germination stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MKRSRGSSDS LSGFLPIRHS TTDKQISPRP TTTGFLYSGA GDYSQMFDAL EDDGSLEDLG  60
GVGHASSTAA EKKRRLGVEQ VKALEKNFEI DNKLEPERKV KLAQELGLQP RQVAIWFQNR  120
RARWKTKQLE RDYGVLKSNF DALKRNRDSL QRDNDSLLGQ IKELKAKLNV EGVKGIEENG  180
ALKAVEANQS VMANNEVLEL SHRSPSPPPH IPTDAPTSEL AFEMFSIFPR TENFRDDPAD  240
SSDSSAVLNE EYSPNTVEAA GAVAATTVEM STMGCFSQFV KMEEHEDLFS GEEACKLFAD  300
NEQWYCSDQW NS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119127RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.196980.0flower| inflorescence| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247191_at0.0
Expression AtlasAT5G65310-
AtGenExpressAT5G65310-
ATTED-IIAT5G65310-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Localized primarily to the hypocotyl of germinating seedlings. {ECO:0000269|PubMed:12678559}.
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a class I HDZip (homeodomain-leucine zipper) protein that is a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment.
UniProtProbable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment. Binds to the DNA sequence 5'-CAATNATTG-3'. {ECO:0000269|PubMed:12678559}.
Function -- GeneRIF ? help Back to Top
  1. HB5 negatively regulates BDL expression.
    [PMID: 23682118]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00587DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G65310.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:12678559, ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G65310
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G65310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3250540.0AF325054.2 Arabidopsis thaliana AT5g65310 (AT5g65310/MNA5_4) mRNA, complete cds.
GenBankAY0742930.0AY074293.1 Arabidopsis thaliana putative homeobox-leucine zipper protein ATHB-5 (At5g65310) mRNA, complete cds.
GenBankAY0913400.0AY091340.1 Arabidopsis thaliana putative homeobox-leucine zipper protein ATHB-5 (HD-zip protein ATHB-5) (At5g65310) mRNA, complete cds.
GenBankX670330.0X67033.1 A.thaliana mRNA Athb-5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201334.10.0homeobox-leucine zipper protein ATHB-5
SwissprotP466670.0ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5
TrEMBLF4KHX10.0F4KHX1_ARATH; Homeobox-leucine zipper protein ATHB-5
STRINGAT5G65310.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM129861526
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Johannesson H,Wang Y,Engström P
    DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro.
    Plant Mol. Biol., 2001. 45(1): p. 63-73
    [PMID:11247607]
  3. Johannesson H,Wang Y,Hanson J,Engström P
    The Arabidopsis thaliana homeobox gene ATHB5 is a potential regulator of abscisic acid responsiveness in developing seedlings.
    Plant Mol. Biol., 2003. 51(5): p. 719-29
    [PMID:12678559]
  4. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  7. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  8. Lechner E, et al.
    MATH/BTB CRL3 receptors target the homeodomain-leucine zipper ATHB6 to modulate abscisic acid signaling.
    Dev. Cell, 2011. 21(6): p. 1116-28
    [PMID:22172674]
  9. De Smet I, et al.
    Transcriptional repression of BODENLOS by HD-ZIP transcription factor HB5 in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(10): p. 3009-19
    [PMID:23682118]
  10. S
    Expression patterns of novel genes encoding homeodomain leucine-zipper proteins in Arabidopsis thaliana.
    Plant Mol. Biol., 1994. 26(1): p. 145-54
    [PMID:7948864]